PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0178500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 140aa    MW: 16365.3 Da    PI: 10.384
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0178500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.6e-08811162055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yp+ +++  L +++gL+++q+ +WF N+R ++
  Spipo0G0178500  81 YKWPYPTDADKVALVESTGLNQKQINNWFINQRKRR 116
                     4679***************************99764 PP

2ELK35.32.4e-123657122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    EL+++Llr YsgyL+sLkq Fs
  Spipo0G0178500 36 ELRDELLRRYSGYLSSLKQDFS 57
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.513656IPR005539ELK domain
SMARTSM011881.8E-63657IPR005539ELK domain
PfamPF037894.8E-103657IPR005539ELK domain
PROSITE profilePS5007112.0556119IPR001356Homeobox domain
SuperFamilySSF466898.98E-1957133IPR009057Homeodomain-like
SMARTSM003891.3E-1158123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-2761120IPR009057Homeodomain-like
CDDcd000863.36E-1064120No hitNo description
PfamPF059205.4E-1776115IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
RERERREAEA ARSSVEESGG REVGTRGSAA RKEERELRDE LLRRYSGYLS SLKQDFSKKK  60
KKGNLPKEAR QTLLDWWNLH YKWPYPTDAD KVALVESTGL NQKQINNWFI NQRKRRWKPS  120
ESMQFAVLDS LSSPFYLDG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006841054.12e-59PREDICTED: homeobox protein knotted-1-like 2
SwissprotP466391e-47KNAT1_ARATH; Homeobox protein knotted-1-like 1
SwissprotQ84JS69e-48KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLW1P5153e-59W1P515_AMBTC; Uncharacterized protein
STRINGVIT_17s0000g08710.t012e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3229724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-38KNOTTED1-like homeobox gene 6